BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1158 (658 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973... 28 5.7 02_05_0603 - 30295130-30295389,30296840-30296987 28 5.7 >11_06_0300 + 22095396-22096145,22096261-22096344,22097062-22097304, 22098535-22098702,22098895-22099008,22099378-22099890 Length = 623 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 358 GHGAAAPCPESSSHVIPSPKRALAL 284 G GAAAP P SSS P P+ A L Sbjct: 49 GGGAAAPPPSSSSSSAPPPRAAPGL 73 >02_05_0603 - 30295130-30295389,30296840-30296987 Length = 135 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 259 KSKRKKCLIRQELFSEMGSREKSFQGTEPLPHDPTNDLEMVERKGK 396 K K+KK R+E SE G E G+ +P DP ++L ++ G+ Sbjct: 27 KKKKKKKQHREES-SEAGHGELHQGGSSEVPADPNDELTEADKMGE 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,320,038 Number of Sequences: 37544 Number of extensions: 349197 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -