BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1158 (658 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81136-2|CAB03459.1| 743|Caenorhabditis elegans Hypothetical pr... 29 2.9 Z83220-4|CAC42264.1| 617|Caenorhabditis elegans Hypothetical pr... 28 6.7 >Z81136-2|CAB03459.1| 743|Caenorhabditis elegans Hypothetical protein W02B8.3 protein. Length = 743 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +3 Query: 48 MTMLKIYQCVHSSLRDTSLRKILFDAR 128 MT +I++ +HS+++D + +K+ FD R Sbjct: 534 MTRAEIHRSIHSTIKDVADKKLKFDVR 560 >Z83220-4|CAC42264.1| 617|Caenorhabditis elegans Hypothetical protein C34B7.4 protein. Length = 617 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 241 LKFVCEKSKRKKCLIRQELFSEMGSREKSFQGTEPLPHDPTNDLEMVERK 390 L+F + + K L +++L E+ + E F +PLP+ PT+ + ++K Sbjct: 233 LEFEGDIDELKDLLAKRDLTFEILNYEAGFSSKKPLPYTPTSSGKKNKKK 282 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,249,407 Number of Sequences: 27780 Number of extensions: 277982 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -