BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1158 (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02290.1 68414.m00171 expressed protein 34 0.072 At5g01020.1 68418.m00004 protein kinase family protein contains ... 28 4.8 At5g40750.1 68418.m04945 hypothetical protein 27 8.3 At2g40550.1 68415.m05003 expressed protein 27 8.3 >At1g02290.1 68414.m00171 expressed protein Length = 443 Score = 34.3 bits (75), Expect = 0.072 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 277 CLIRQELFSEMGSREKSFQGTEPLPHDPTNDLEMVERKGKLTIT-YKIPI 423 C I + + + ++S QGTEP+ HDPT+ + R +IT IP+ Sbjct: 314 CSIPDPFLTYLETTQRSIQGTEPVFHDPTHTVPSALRVSNYSITEQNIPL 363 >At5g01020.1 68418.m00004 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 410 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 507 NTI*WARNKSTHLSNKKKLRLLVAQAVENRYFIGYGQLTFSLDHF 373 N + WAR K L++K+KL ++ +EN+Y + Q SL ++ Sbjct: 286 NLVDWARPK---LNDKRKLLQIIDPRLENQYSVRAAQKACSLAYY 327 >At5g40750.1 68418.m04945 hypothetical protein Length = 297 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 344 RCPMTLPTTWKWSSEKVS*P*PIKYRFST 430 R ++L +TWKW+ +K+ YR ST Sbjct: 239 RAGISLKSTWKWNKKKIMKELKSMYRIST 267 >At2g40550.1 68415.m05003 expressed protein Length = 589 Score = 27.5 bits (58), Expect = 8.3 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -2 Query: 516 VTTNTI*WARNKSTHLSNKKKLRLLVAQAVENRYFIGYGQLTFSLDHFQVVGRVMGQRLR 337 V N + AR L ++ RLL + + + YG+ T SL+H+Q+V + R Sbjct: 530 VVENDLVAARQTDRSLGSQDLSRLLTMARMMS---VSYGETTLSLEHWQMVLELERLRKE 586 Query: 336 ALK 328 LK Sbjct: 587 RLK 589 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,528,502 Number of Sequences: 28952 Number of extensions: 265066 Number of successful extensions: 499 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -