BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1157 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0965 + 33136373-33136512,33136595-33136688,33136845-331368... 29 3.6 >02_05_0965 + 33136373-33136512,33136595-33136688,33136845-33136889, 33137007-33137174,33137247-33137331,33137531-33137637, 33137918-33137998,33138232-33138284,33138361-33138460, 33138911-33139054,33139268-33139364,33139528-33139611, 33139904-33140123,33140204-33140297,33140406-33140975, 33141348-33141449,33141564-33141656,33141834-33141836 Length = 759 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 109 IFVIKDAFYLVSSINNSMFLIELQLSLHHSNN*SFFFIMIYFLQ-ILNFNGSAVKLQKCR 285 +F+I F VSS+ +S F+ E Q + H+ + + +I Q +L + SAV + + Sbjct: 557 VFIIMGIFLYVSSLGSSSFVEEEQYTWHYLTSTLYLIFLIKTTQSMLRESNSAVARAEGK 616 Query: 286 LYQNS 300 ++ + Sbjct: 617 IFHGN 621 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,424,272 Number of Sequences: 37544 Number of extensions: 271886 Number of successful extensions: 351 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -