BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1157 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 25 3.1 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 5.4 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 463 YFFYLNIFLGWFNMM 507 Y+ +L IFLGW NM+ Sbjct: 27 YYEWLPIFLGWENMV 41 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 209 VFFLL*YIFSKF*TLMALL*SCKNVAYTKIAIHL 310 V +L YIF LMAL+ +NV TK A+ L Sbjct: 63 VIVMLSYIFGCVGNLMALIHLWRNVRNTKHALML 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,275 Number of Sequences: 2352 Number of extensions: 12832 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -