BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1157 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical pr... 31 1.1 U28929-4|AAA68347.3| 338|Caenorhabditis elegans Hypothetical pr... 29 3.3 >Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical protein K10C8.2 protein. Length = 425 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/92 (23%), Positives = 43/92 (46%) Frame = +1 Query: 61 CHDVEG*KAVFVYVTFIFVIKDAFYLVSSINNSMFLIELQLSLHHSNN*SFFFIMIYFLQ 240 C ++E A F++ +++F YL I+NS+ + ++ ++FF+ + F Sbjct: 10 CQEIEFTHAQFLFRSYLFPF---VYLFGIISNSINICVFSQKSMRNHTVNWFFLALSFSD 66 Query: 241 ILNFNGSAVKLQKCRLYQNSHSP*PNLTLSVE 336 +L S +NSH+P + LSV+ Sbjct: 67 LLTLVASIFVFSVPVYAENSHNP-EYIDLSVQ 97 >U28929-4|AAA68347.3| 338|Caenorhabditis elegans Hypothetical protein F09C12.6 protein. Length = 338 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +1 Query: 28 YRELTFFILFYCHDVEG*KAVFV--YVTFIFVIKDAFYLVSSINNSMFLIELQLSLH 192 YR+ +L+YC G KA F Y TFI++ + YL S + N + +I+ +++ Sbjct: 172 YRKRNVKVLYYC----GRKAAFGNDYATFIYICNISGYLFSFLINCITMIKASSTIN 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,655,555 Number of Sequences: 27780 Number of extensions: 289179 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -