BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1155 (794 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce... 27 4.1 SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharom... 26 7.1 SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 26 7.1 SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac... 26 7.1 >SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 118 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKVPNAEDK 249 DF EN+ + +L + + ++ KDG + +D+ + N K Sbjct: 84 DFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGK 127 >SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 693 Score = 25.8 bits (54), Expect = 7.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 448 DYIGEYCNLVWCYYSNFNLYRSIN 519 DY+ E NL+ Y S F RS+N Sbjct: 253 DYVDEDLNLINAYLSQFGKKRSLN 276 >SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 528 Score = 25.8 bits (54), Expect = 7.1 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 257 YFNLSSALGTLARATSFLNFPSLVIS--CDLISIH 159 Y NLSSAL T+ F FP+ +++ C++ H Sbjct: 173 YQNLSSALDTILHIKKFSKFPNGLVTQLCNIFVNH 207 >SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 848 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 4 VLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYA 156 V + +TD N+ + L E + + ++K KT DFK + + YA Sbjct: 621 VASDKITDSSPGNMSEASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYA 671 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,166,307 Number of Sequences: 5004 Number of extensions: 64943 Number of successful extensions: 182 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -