BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1155 (794 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.50 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.67 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 4.7 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 6.2 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 6.2 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 6.2 At4g23280.1 68417.m03355 protein kinase, putative similar to rec... 28 6.2 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.50 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +1 Query: 25 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 201 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 360 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 265 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 381 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 289 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 1 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 171 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 172 KSQLMTKDGKFKK 210 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 1 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 171 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 172 KSQLMTKDGKFKK 210 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 52 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 225 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 226 KVPN 237 N Sbjct: 287 DGEN 290 >At4g23280.1 68417.m03355 protein kinase, putative similar to receptor-like protein kinase 4 (gi:13506745), 5 (gi:13506747), and 6 (gi:13506749) from Arabidopsis thaliana; contains Pfam protein kinase domain PF00069 Length = 656 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 792 FFFFFQYYGSYCCTKNIKFAKKVNVALT*AYYSHVTYGTN-KTL 664 F F F + S+ + F N ++T Y S+ TY TN KTL Sbjct: 9 FLFLFSFITSFTASAQNPFYLYHNCSITTTYSSNSTYSTNLKTL 52 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,147,057 Number of Sequences: 28952 Number of extensions: 324345 Number of successful extensions: 763 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -