BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1154X (379 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 1.3 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 20 9.5 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 20 9.5 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.6 bits (46), Expect = 1.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 135 LMLTPNKNRAVKNFLNMGLICRLPKMVPCC 224 ++L +K + +K+F N G ++ CC Sbjct: 79 IILVFSKGKVIKSFFNQGYELSKQEIFNCC 108 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 324 GKIPVKSLVYPYRKE 280 G IP KS YP +++ Sbjct: 53 GPIPTKSSKYPIKRK 67 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 19.8 bits (39), Expect = 9.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 37 LFN*IFGNYY*ILELLTTYHLI 102 LFN +FG +L LTT L+ Sbjct: 207 LFNSLFGFLVLLLVALTTLQLL 228 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,100 Number of Sequences: 336 Number of extensions: 1746 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 7803226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -