BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1154X (379 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 3.6 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 20 8.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 20 8.4 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 3.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 367 ARAKTQRNQVEMQKRKNPSEKPGLPLQEGNPGDAE 263 ARAK + + E +K S K G PG E Sbjct: 332 ARAKKKSKKKESDDKKVISSKSGSKANSPFPGSTE 366 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 8.4 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = +3 Query: 54 WELLLNFRIAYNISLDKNFH 113 W+L+ + + YN ++ K H Sbjct: 364 WDLIAPYFLDYNYTIPKEKH 383 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 8.4 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = +3 Query: 54 WELLLNFRIAYNISLDKNFH 113 W+L+ + + YN ++ K H Sbjct: 364 WDLIAPYFLDYNYTIPKEKH 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,292 Number of Sequences: 438 Number of extensions: 2117 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -