BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1153 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa... 27 4.1 SPBC1734.16c |pst3||SIN3 family co-repressor|Schizosaccharomyces... 26 7.1 >SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 26.6 bits (56), Expect = 4.1 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -3 Query: 191 LNLKKYMYIYIVPFFLTHIYIYIYVGLVRMQHMKSVERNVK 69 LNLK+ ++++ +F+ HIYI I + + ++ ++ Sbjct: 431 LNLKESIHVWKELYFIVHIYILIALAVFNSPIRSKLDNKIR 471 >SPBC1734.16c |pst3||SIN3 family co-repressor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1154 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -2 Query: 423 FAGRREQYSRYLYRQKNRKSQNKTYIFGIVNLVRVLY 313 F+ RRE Y+R+L ++ KSQ + G++N V L+ Sbjct: 129 FSERREIYNRFLEIMRDFKSQALDTL-GVINRVSELF 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,101,447 Number of Sequences: 5004 Number of extensions: 67504 Number of successful extensions: 166 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -