BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1148 (341 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 55 6e-10 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 24 1.4 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 2.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 2.4 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 2.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 2.4 DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 22 5.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 5.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 5.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 22 5.5 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 22 7.2 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 22 7.2 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 21 9.6 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 21 9.6 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 21 9.6 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 21 9.6 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 55.2 bits (127), Expect = 6e-10 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +2 Query: 2 RRYALPENCNPDTVESRLSSDGVLTVIAPRTPAATKN-ERAVPITQTGPVRKEIKEPTAE 178 RRY LP+ N + S LSSDG+LT+ PR KN ER++PIT TG K++ A Sbjct: 60 RRYMLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQVTGKAAP 119 Query: 179 VESNETKQ 202 + K+ Sbjct: 120 ENGHSKKE 127 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 148 PEGD*GAHCGS*EQRNK 198 P GD GAHCG+ + N+ Sbjct: 321 PYGDTGAHCGNHQDLNE 337 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 254 NKINTRYTFLIHSVPRVIVLFRCSQLPQWAP*SPSGPGRF 135 N+ N RYTFL+ + C Q+ + + P GP R+ Sbjct: 161 NRPNVRYTFLLRQLNHGGDHAECGQVERKS--QPFGPARW 198 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 85 SQDSGCHEERASCSHHSNRPGPEGD*GAHCG 177 S D G AS S ++ P P G G H G Sbjct: 1401 STDGGESMGTASTSSQTDEPRPGGSGGGHTG 1431 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 2.4 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = -2 Query: 190 VALNFRSGLLNLLPDRAGLSDGNSSLVLRGSRSPGSDHGQHAVRGQPRFDSVGVTVFWQS 11 VA NF L+P GN L+LR + + + V F +G+ V + Sbjct: 1035 VAANFSEVFKKLVPQ------GNGHLILRTTNDQEGNDMEREVETSDEFTGIGIRVSFTQ 1088 Query: 10 V 8 V Sbjct: 1089 V 1089 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 121 SSLVLRGSRSPGSDHGQHAVRGQPRFDSVG 32 SS SR GSD G H++ + D G Sbjct: 1345 SSKFSTSSRGSGSDSGSHSISSAAQHDFQG 1374 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 124 SHHSNRPGPEGD*GAHCGS*EQRNKTMTLGT 216 S S PGPEG G S ++ TLGT Sbjct: 1410 SGRSKPPGPEGVGGGGGKSPSDKHNPGTLGT 1440 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 98 AATKNERAVPITQTGPVRKEIKEPTAEVESN 190 A TKN + + + +T + K ++ A +ESN Sbjct: 70 AVTKNIQHLTLCETRSLLKSLQTDEASMESN 100 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -1 Query: 308 IKYKYDKAISLTSTHEECNKINTRYTFLIHSVPRVIV 198 ++Y+YD L + + NTRY + + R +V Sbjct: 1880 MRYEYDNQSGLLTLKRTPDAGNTRYMYTPEGLLRFVV 1916 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -1 Query: 308 IKYKYDKAISLTSTHEECNKINTRYTFLIHSVPRVIV 198 ++Y+YD L + + NTRY + + R +V Sbjct: 1881 MRYEYDNQSGLLTLKRTPDAGNTRYMYTPEGLLRFVV 1917 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -1 Query: 116 ARSSWQPESWERSRS 72 A +SW P WE ++ Sbjct: 2709 ANNSWNPAKWELKKA 2723 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +1 Query: 100 CHEERASCSHHSNRPGPEGD*GAHC 174 CHEE CS ++ G G C Sbjct: 465 CHEEGMECSEQCSKAGCWGKGPEQC 489 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -2 Query: 220 TAFRESLFCFVALNFRSGLLNLLPDRAGL 134 + + ++C++ FRSG + +L GL Sbjct: 560 SCYNPIIYCYMNARFRSGFILVLHGVPGL 588 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -2 Query: 130 DGNSSLV--LRGSRSPGSDHGQHAVRG 56 + NS L L + PGS++GQ ++G Sbjct: 25 ESNSDLYGPLHANYGPGSNNGQEGLKG 51 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 21.4 bits (43), Expect = 9.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 169 GLLNLLPDRAGLSDGNSSLVLRGSRSPGSDHGQH 68 G + +P +G S NSS ++ S + DH H Sbjct: 877 GFVFSVPFNSGYSGKNSSTLVTASHAIFIDHRGH 910 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 154 LPDRAGLSDGNSSLVLRGSRSPGSDHGQHAVRGQP 50 LP + G L+G P + G+ + GQP Sbjct: 360 LPGQKGDRGSEGLHGLKGQSGPKGEPGRDGIPGQP 394 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 101 QPESWERSRSARRQRTA 51 QP +++ +ARRQRTA Sbjct: 215 QPPREQQTGTARRQRTA 231 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 122 VPITQTGPVRKEIKEPTAEVESNE 193 VP E EPT EVE E Sbjct: 1078 VPAVLARAAANEAAEPTGEVEEEE 1101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,239 Number of Sequences: 2352 Number of extensions: 6269 Number of successful extensions: 25 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24075240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -