BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1143 (572 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0458 - 34077649-34077849,34077956-34078127,34078803-34079290 29 3.5 01_02_0086 - 10979236-10979396,10980288-10980798,10984446-109849... 28 4.6 02_05_0717 + 31190626-31191234,31191954-31192394,31192699-311928... 28 6.1 04_04_0176 - 23329589-23331043 27 8.0 >03_06_0458 - 34077649-34077849,34077956-34078127,34078803-34079290 Length = 286 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/49 (34%), Positives = 31/49 (63%) Frame = +3 Query: 69 SGGDAADSAPRVTRAPTITASRVRDHVSSLLVIFYVSVRSVQVMRTTNN 215 + G+AA +A + TRA ++ S +R H SSL+++ + + ++ V TT N Sbjct: 31 AAGEAA-AAKKATRAWGVSVS-LRSHFSSLVLLLLLLLVALAVSATTKN 77 >01_02_0086 - 10979236-10979396,10980288-10980798,10984446-10984977, 10984983-10985002 Length = 407 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 1 PRPPEPKSTSPARGAPCRLANE--ALAETRRTQLRASLGLQQ 120 PRPP P S SP A +L +E LA +R ++ L++ Sbjct: 284 PRPPRPPSASPLDAADQKLISELSELASLKRARIERMKALKK 325 >02_05_0717 + 31190626-31191234,31191954-31192394,31192699-31192802, 31193000-31194384,31194508-31194548,31195065-31195133, 31195335-31195435,31195747-31195825,31195939-31196037, 31196119-31196187,31197609-31197658,31197749-31197925, 31198045-31198152,31198224-31198290 Length = 1132 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 1 PRPPEPKSTSPARGAPCRLANEALAETRRTQLRASLGLQQ*QQAE 135 P+PP P + S A G+P + + AE RR + A Q ++ E Sbjct: 64 PQPPTPSTPSEAEGSPFSSSVGSGAEERRQSVAAERRRSQEEEWE 108 >04_04_0176 - 23329589-23331043 Length = 484 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 24 NLSCPRRTLPTSERGSGGDAADSAPRVTR 110 +LSCP LP G G D APR R Sbjct: 198 SLSCPPTLLPLGGGGGGDDPHVHAPRAAR 226 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,004,681 Number of Sequences: 37544 Number of extensions: 188152 Number of successful extensions: 846 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -