BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1141X (456 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 1.0 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 7.2 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.4 bits (48), Expect = 1.0 Identities = 9/47 (19%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 317 IDPNVGLTELPEEYFEGESEA-MRLDKGVMQEIVGAFPGIDEAMSYA 454 +DP + + + P + +GE ++ + ++ V+ + P ++A+ A Sbjct: 64 VDPEIDIEDKPAQKIDGEDDSGLTEEEVVLSNAIAEGPDAEKALQRA 110 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 20.6 bits (41), Expect = 7.2 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 100 RSKVVKVDFRWRERRSWEN 156 R K++K RWR W + Sbjct: 171 RDKLLKAFTRWRMEGDWSD 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,822 Number of Sequences: 336 Number of extensions: 1761 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -