BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1141X (456 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 1.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 6.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 6.3 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/36 (25%), Positives = 16/36 (44%) Frame = -3 Query: 247 SEILWAGSVDMINTDSRTFDQLNCETATARSFPNSA 140 S+ +W + + N+ TFDQ T F + + Sbjct: 121 SDDIWVPDISVYNSGDMTFDQTGIPPTTCLVFSSGS 156 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 374 EAMRLDKGVMQEIVGAFPGI 433 EA+RLD + +I G F I Sbjct: 529 EAIRLDGNFLSDINGVFTSI 548 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 264 FLKYQQRLKGLTTYSLWRLIRMLD 335 F K QR+K Y +WR R+++ Sbjct: 132 FKKSVQRIKPYDEYYVWRDARIVN 155 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,759 Number of Sequences: 438 Number of extensions: 2196 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -