BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1140 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 28 5.4 SB_58489| Best HMM Match : Ank (HMM E-Value=4.7e-08) 28 7.1 >SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1214 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = -1 Query: 614 PTRNTLTSVMCLLFRLSI 561 PTRNT+ S++C+L+ +SI Sbjct: 912 PTRNTIISIICILWGISI 929 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 122 NEKYVRLHCINCLAYVNDGKSFECNAELCAN 30 +EK +RLH NC AY D E NA N Sbjct: 34 SEKTIRLHYANCKAYNADFDGDEMNAHFPQN 64 >SB_58489| Best HMM Match : Ank (HMM E-Value=4.7e-08) Length = 1188 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 417 TDADKPRTSEIAMNSKF 467 T+ DKPRTS+I NS F Sbjct: 728 TNGDKPRTSDIGRNSNF 744 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,407,347 Number of Sequences: 59808 Number of extensions: 326907 Number of successful extensions: 783 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -