BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1139X (408 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 35 0.004 SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosac... 24 7.9 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 35.1 bits (77), Expect = 0.004 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 234 GWGLGRASPAESGAYPAHYAPNYSPHRPANTPP 332 GW LG S + G +P++Y P+ AN PP Sbjct: 761 GWWLGENSKGQQGLFPSNYVEITGPNETANNPP 793 >SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 24.2 bits (50), Expect = 7.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 318 RVGAASS*ARSVPGMRRIPRGTRARAPTPS 229 R G S P MRR P G +R+P+ S Sbjct: 340 RAGTPQSSPNFNPAMRRSPVGAASRSPSRS 369 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.133 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,044,891 Number of Sequences: 5004 Number of extensions: 13582 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 140222766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -