BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1138 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma c... 28 1.5 SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces... 27 2.6 SPCC330.07c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 5.9 >SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma catalytic subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 1018 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -3 Query: 579 SNNSFVTDRVDWTTSSRAC--LHLL 511 S NSF+T RV+W S A LHLL Sbjct: 841 SKNSFMTSRVNWAIQSSAVDYLHLL 865 >SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces pombe|chr 1|||Manual Length = 369 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 40 NVIWGGGVSPSGNPAPTINLLYPSISLHAIQREPSPALYM-VLNYELRLPELSQQAG 207 N++ SG P+ N L + S+ + ++EPS L++ L++E +L + G Sbjct: 193 NILIKSNTDFSGRPSKPANTLSKTASIQSSKKEPSSILFVGNLDFETTDADLKEHFG 249 >SPCC330.07c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 500 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +1 Query: 487 VTATTRTCQQVKTGARASRPVDTICNKTVVRVTF*FLIINA 609 V + T T Q ++ + PVD NK +V+ F++IN+ Sbjct: 56 VESVTETFQSNRSSLVPTYPVDENANKLPPKVSIAFILINS 96 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,332,665 Number of Sequences: 5004 Number of extensions: 37967 Number of successful extensions: 96 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -