BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1138 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62290.1 68418.m07820 nucleotide-sensitive chloride conductan... 33 0.24 At1g14780.1 68414.m01767 expressed protein 30 1.7 >At5g62290.1 68418.m07820 nucleotide-sensitive chloride conductance regulator (ICln) family protein contains PF03517: Nucleotide-sensitive chloride conductance regulator (ICln) Length = 229 Score = 32.7 bits (71), Expect = 0.24 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = +1 Query: 19 TLYITENNVIWGGGVSPSGNPAPTINLLYPSISLHAIQREP----SPALYMVLNYE 174 TLYIT +IW V + A ++ L SISLHA+ R+P SP +Y + E Sbjct: 50 TLYITSRKLIWLSDVDMAKGYA--VDFL--SISLHAVSRDPEAYSSPCIYTQIEVE 101 >At1g14780.1 68414.m01767 expressed protein Length = 627 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 34 ENNVIWGGGVSPSGNPAPTINLLYPSISLHAIQREP--SPALYMVLNYELRL 183 +N V+ GV P G P P N + + L + R P SP ++V L L Sbjct: 553 KNEVVLDSGVFPGGPPVPANNKIVKFVDLSQLCRGPQHSPGHWLVTGVRLYL 604 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,431,365 Number of Sequences: 28952 Number of extensions: 208709 Number of successful extensions: 495 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -