BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1137 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 39 2e-04 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 24 4.2 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 38.7 bits (86), Expect = 2e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +3 Query: 363 TQRLPRYVGKSKAMEIVLTGNFFDAHEAEKMGLVSKVFPV 482 T RLP +G S+A++++LTG A EA +GLV++V V Sbjct: 188 TVRLPALIGLSRALDLILTGRTVTAKEALDIGLVNRVVAV 227 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 387 GKSKAM--EIVLTGNFFDAHEAEKMGLVSKV 473 GK KAM IV GN D H AEK V ++ Sbjct: 141 GKLKAMFHTIVDVGNRLDQHLAEKCQQVKRI 171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,149 Number of Sequences: 2352 Number of extensions: 16002 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -