BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1137 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 1.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.8 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/57 (22%), Positives = 28/57 (49%) Frame = +3 Query: 321 SARDQHWLHPRSRSTQRLPRYVGKSKAMEIVLTGNFFDAHEAEKMGLVSKVFPVENF 491 S +D L+P+ R P+++G+ + +T D+ E M V+ +F +++ Sbjct: 5 SLKDILPLNPKLYDKHRAPKFLGQPTIVYFHVTVLSIDSINEESMTYVADIFLAQSW 61 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 426 SFLSTRSPLLSTCQRIWEDAGC 361 +FLS S L +W D GC Sbjct: 1506 TFLSPNSTTLVLRLHVWPDNGC 1527 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 426 SFLSTRSPLLSTCQRIWEDAGC 361 +FLS S L +W D GC Sbjct: 1502 TFLSPNSTTLVLRLHVWPDNGC 1523 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,957 Number of Sequences: 438 Number of extensions: 4295 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -