BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1135 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 28 1.4 SPAC1805.09c |fmt1||methionyl-tRNA formyltransferase Fmt1 |Schiz... 27 3.3 SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma... 27 3.3 SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac... 26 5.8 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 25 7.7 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.9 bits (59), Expect = 1.4 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +1 Query: 7 CIMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFK 168 C + F+V V V A LTDE+K L K R + S + E+L K FK Sbjct: 233 CAIVIFLVLPVSVETANFLTDEEK-TLAKMRIENDSSSAISEKLSFKQSLTVFK 285 >SPAC1805.09c |fmt1||methionyl-tRNA formyltransferase Fmt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 340 Score = 26.6 bits (56), Expect = 3.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 501 RIFNLVWCYYSNFNLYLFD 557 R FN VWC +N ++L+D Sbjct: 251 RAFNHVWCILNNKKVFLYD 269 >SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 629 Score = 26.6 bits (56), Expect = 3.3 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 10 IMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGD-FKTENEPL 186 I+ TF++FVV ++L + L ++ K+ + + + E KL GD F+ P+ Sbjct: 274 IIDTFLIFVVSIILYRTL----NRDINKYNSAFVDQEDVQEDFGWKLVHGDVFRPPRRPM 329 >SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 848 Score = 25.8 bits (54), Expect = 5.8 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 46 VLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYA 198 V + +TD N+ + L E + + ++K KT DFK + + YA Sbjct: 621 VASDKITDSSPGNMSEASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYA 671 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 25.4 bits (53), Expect = 7.7 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +1 Query: 382 RKTRSTLFSCKH---IIQPNRSIPH*C*IARTCLSRRYHDYIGEYSILYG 522 RK RS F + IIQ C I TC+S + I EY +L+G Sbjct: 7 RKERSVAFITEKYAAIIQKPSVKDSDCIITFTCISLEEFEKIKEYELLFG 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,780,570 Number of Sequences: 5004 Number of extensions: 58489 Number of successful extensions: 169 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -