BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1131X (309 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 0.55 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 20 6.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 0.55 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 76 PVSSPTSSVNLE*PLEVTRIDVFPVASVKTTASTRAPIFLP 198 P S PT + P +R + +SV TTAS + ++ P Sbjct: 81 PSSLPTQRTSTSNPTYSSRSVMTSCSSVPTTASYGSDLYFP 121 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 19.8 bits (39), Expect = 6.8 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 241 LNKSLYCNCDAWR 203 LN L+CN WR Sbjct: 150 LNFMLHCNNTTWR 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,093 Number of Sequences: 336 Number of extensions: 821 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5624413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -