SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1131X
         (309 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    23   0.55 
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    20   6.8  

>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 23.4 bits (48), Expect = 0.55
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 76  PVSSPTSSVNLE*PLEVTRIDVFPVASVKTTASTRAPIFLP 198
           P S PT   +   P   +R  +   +SV TTAS  + ++ P
Sbjct: 81  PSSLPTQRTSTSNPTYSSRSVMTSCSSVPTTASYGSDLYFP 121


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 19.8 bits (39), Expect = 6.8
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 241 LNKSLYCNCDAWR 203
           LN  L+CN   WR
Sbjct: 150 LNFMLHCNNTTWR 162


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,093
Number of Sequences: 336
Number of extensions: 821
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 49
effective length of database: 106,121
effective search space used:  5624413
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -