BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1131X (309 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18E5.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 1.5 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 25 1.9 SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch... 24 4.5 SPCC13B11.01 |adh1|adh|alcohol dehydrogenase Adh1|Schizosaccharo... 24 5.9 SPAC959.02 |sec17||alpha SNAP |Schizosaccharomyces pombe|chr 1||... 23 7.9 >SPBC18E5.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 73 GPVSSPTSSVNLE*PLEVTRIDVF 144 GPV P +SVN + V+ IDVF Sbjct: 550 GPVRRPPTSVNTKPSFSVSGIDVF 573 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 25.4 bits (53), Expect = 1.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 154 SVKTTASTRAPIFLPQSAMRRNCSKD 231 S K S APIF+P S+++ N SK+ Sbjct: 62 SSKFHPSASAPIFVPTSSVQLNVSKN 87 >SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 208 MRRNCSKDFYLVPDIDYMLLQL*KNGTPHHRDH 306 M+ CS FY P I L+Q K H+ H Sbjct: 801 MKTPCSSGFYRDPKIIIDLMQFGKTDLSFHKVH 833 >SPCC13B11.01 |adh1|adh|alcohol dehydrogenase Adh1|Schizosaccharomyces pombe|chr 3|||Manual Length = 350 Score = 23.8 bits (49), Expect = 5.9 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = -2 Query: 224 LQLRRMALCGKNIGARVDAV 165 L ++ + +CG ++G R+D++ Sbjct: 286 LTVKMLKICGSHVGNRIDSI 305 >SPAC959.02 |sec17||alpha SNAP |Schizosaccharomyces pombe|chr 1|||Manual Length = 289 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 304 DHDDAASRFFIAVKAYNR 251 D DDAAS + A K+Y R Sbjct: 70 DKDDAASTYVEAFKSYRR 87 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 833,888 Number of Sequences: 5004 Number of extensions: 12629 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -