Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1126
         (780 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7R9G0 Cluster: Putative uncharacterized protein PY0690...    35   2.6  

>UniRef50_Q7R9G0 Cluster: Putative uncharacterized protein PY06902;
           n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY06902 - Plasmodium yoelii yoelii
          Length = 689

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = -2

Query: 632 NVQRPLQNSLFIIISIHYVLSKQIKRENKNKRNLD--YQVIVNKSIILN*ISRKHRSHKK 459
           N ++  +  L  I++ + V+    +   K K+NLD  Y++   K ++LN I +    HKK
Sbjct: 491 NFKKMSKEKLIEILNEYKVIFNDYQSSEKKKKNLDKNYKLKELKKLLLNEIEKNKIIHKK 550

Query: 458 YKN 450
           Y+N
Sbjct: 551 YQN 553


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 667,833,882
Number of Sequences: 1657284
Number of extensions: 12794928
Number of successful extensions: 23776
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22786
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23770
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 65850543200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)