BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1126 (780 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3F10.10c |map3||pheromone M-factor receptor |Schizosaccharom... 26 7.0 SPAC1142.04 |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 25 9.2 >SPAC3F10.10c |map3||pheromone M-factor receptor |Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 661 NSYVIFFFERMCSGLYKIHCLLLFLYITSCL 569 N YV+ S Y+ LLF YI CL Sbjct: 136 NRYVVICMNGCYSSFYQTWYTLLFFYIPPCL 166 >SPAC1142.04 |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 707 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = -2 Query: 197 QMLYIYIYTINGLLNRHHDFLTSNIVNMFVLES*ACMLLRF 75 Q Y ++T++ + +FL ++ VN+F+L++ +C L+ F Sbjct: 368 QSAYTTVHTLDKI-----NFLKNSAVNLFLLDAESCYLIGF 403 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,002,268 Number of Sequences: 5004 Number of extensions: 61721 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -