BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1126 (780 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68650.1 68414.m07844 expressed protein contains Pfam profile... 29 2.6 At4g26380.1 68417.m03795 DC1 domain-containing protein contains ... 28 8.0 >At1g68650.1 68414.m07844 expressed protein contains Pfam profile PF01169: Uncharacterized protein family UPF0016 Length = 228 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 108 SRKLSLHVTTFLFF-YVSWSKQDG 40 SRK + H+TTFLFF + WS DG Sbjct: 67 SRKWTHHITTFLFFGFGLWSLWDG 90 >At4g26380.1 68417.m03795 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1016 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 776 CQCCQIDPGSLLYLHYCIQDLTFQSPSACTK 684 C CC D LL++ YC F ACTK Sbjct: 566 CYCCDED---LLHIFYCCLACNFSMNVACTK 593 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,563,066 Number of Sequences: 28952 Number of extensions: 273756 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -