BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1122 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 25 0.59 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 22 3.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 3.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.6 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 21 9.6 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 21 9.6 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 24.6 bits (51), Expect = 0.59 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 191 EEHHERPPFVPYEYMRIRTKRSHGVMDRSPFSTTLM 298 ++H +RPP +E R S G++ R+ T M Sbjct: 252 DDHRDRPPRHFHEEHDTRRASSRGIIPRAKIKTVKM 287 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = -3 Query: 405 LTFNNLKYMNVLQTNFLKQNYCNLVV 328 + ++N+ +LQ++ L +NY N ++ Sbjct: 25 IKYDNVNLKEILQSDRLTENYVNCLL 50 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 268 GQKSLFHNPHVNALPSGYEDDH 333 G + L H+PH+N Y +H Sbjct: 35 GLQGLHHSPHLNHAMHPYHANH 56 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 393 NLKYMNVLQTNFLKQNYCNLVVIFITA 313 N+KY N+L+T + + N + A Sbjct: 119 NIKYRNLLETTTRRLAFVNSAYTLVKA 145 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 20.6 bits (41), Expect = 9.6 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -3 Query: 351 QNYCNLVVIFIT 316 Q YC+++++F+T Sbjct: 74 QRYCSVLLVFLT 85 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 20.6 bits (41), Expect = 9.6 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -3 Query: 351 QNYCNLVVIFIT 316 Q YC+++++F+T Sbjct: 70 QRYCSVLLVFLT 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,598 Number of Sequences: 336 Number of extensions: 2561 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -