BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1122 (560 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1739.09c |cox13||cytochrome c oxidase subunit VIa|Schizosacc... 35 0.009 SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 25 5.8 >SPCC1739.09c |cox13||cytochrome c oxidase subunit VIa|Schizosaccharomyces pombe|chr 3|||Manual Length = 130 Score = 34.7 bits (76), Expect = 0.009 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 244 YKAFPWGDGQKSLFHNPHVNAL 309 +K +PWGDG K+LF N VN L Sbjct: 104 FKKYPWGDGSKTLFWNDKVNHL 125 Score = 29.5 bits (63), Expect = 0.35 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +2 Query: 116 WKRMSFFVAFPAIALGMLNA---YLAHQEE-HHERPPFVPYEYMRIRTKR 253 WK++++++ PA+ L NA Y HQE H Y + +R K+ Sbjct: 57 WKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKK 106 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.4 bits (53), Expect = 5.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 339 NLVVIFITAGKGIHMRVVEKGLLSITPWERFVRM 238 +L V+ A +H++ +K ++S T WE +RM Sbjct: 370 SLFVVLTDAVIIVHVQEDDKDIVSRTSWEEVIRM 403 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,009,062 Number of Sequences: 5004 Number of extensions: 39784 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -