BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1122 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 3.0 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 9.0 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 9.0 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 328 HLHNRWEGHSHEGCGKGTSVHHPMGTLCTNAH 233 H H W H E K T + H + L N H Sbjct: 814 HAHLSWVPHVKEITLKATRIVHAVNRLMPNLH 845 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 450 TLLFTIINKNVTFFLN 497 TL+FTI+N+ V F N Sbjct: 377 TLVFTILNQPVKFIAN 392 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 344 IVI*WSSS*PLGRAFT*GLWKRDFCPSPHGNA 249 +++ W S PLG L D C +P G A Sbjct: 7 LIVSWCSLVPLGATVGQSLNSGDPCQTPSGTA 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,026 Number of Sequences: 2352 Number of extensions: 10228 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -