BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1120 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 7.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.5 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.5 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 399 TGKLYVVANYYPPGNYSGLFVKNVLPPGAMQ 491 TGK+ + +P + L ++ + PGAM+ Sbjct: 231 TGKVVYFTSLFPYALLTILLIRGLTLPGAME 261 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 399 TGKLYVVANYYPPGNYSGLFVKNVLPPGAMQ 491 TGK+ + +P + L ++ + PGAM+ Sbjct: 284 TGKVVYFTSLFPYALLTILLIRGLTLPGAME 314 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 420 ANYYPPGNYSGLFVKNVLP 476 AN + G+ VKN++P Sbjct: 588 ANVFAKGDMEAFLVKNIIP 606 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 109 EAKRHALVCIHYGLPML 59 E HA++C++ GL M+ Sbjct: 333 ERPDHAVLCVYMGLSMV 349 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 113 TRGETPCSRLYSLWTSNASFSKSFDLEVNSLLI 15 +RG+ SR+ L + S+ EV SLL+ Sbjct: 19 SRGDNDRSRIARLGRDDGGKSRQSSFEVTSLLM 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,337 Number of Sequences: 438 Number of extensions: 3930 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -