BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1119 (727 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00015B4812 Cluster: PREDICTED: similar to ENSANGP000... 33 7.2 UniRef50_A3S379 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 >UniRef50_UPI00015B4812 Cluster: PREDICTED: similar to ENSANGP00000012576; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000012576 - Nasonia vitripennis Length = 667 Score = 33.1 bits (72), Expect = 7.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 45 YCLF*ICALFFGRFYERIEIFSESFRTFQFQCSKF 149 YCLF IC +F + +R+ IF+ S+ + C F Sbjct: 134 YCLFKICIIFREPYVDRLTIFASSYVILIYSCRTF 168 >UniRef50_A3S379 Cluster: Putative uncharacterized protein; n=1; Prochlorococcus marinus str. MIT 9211|Rep: Putative uncharacterized protein - Prochlorococcus marinus str. MIT 9211 Length = 872 Score = 33.1 bits (72), Expect = 7.2 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +3 Query: 420 LKIKYISNKNICIDNSLPGYSN*IKKNLSRRPRKLHLLSIPI 545 +K+KY+S+KNI L YS +K L+R + L+ LSIP+ Sbjct: 1 MKVKYLSSKNI-----LAKYSLYLKSKLNRNRKLLYFLSIPL 37 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,342,579 Number of Sequences: 1657284 Number of extensions: 10251838 Number of successful extensions: 22798 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22786 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -