BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1119 (727 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U20861-15|AAA62290.2| 162|Caenorhabditis elegans Hypothetical p... 30 1.5 Z49908-8|CAA90098.1| 153|Caenorhabditis elegans Hypothetical pr... 28 5.9 >U20861-15|AAA62290.2| 162|Caenorhabditis elegans Hypothetical protein C28H8.2 protein. Length = 162 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 55 FKFAHYFLGDFMRESKSFQNLFEHFNF 135 F F YF+G F R ++ + EHFN+ Sbjct: 42 FHFLQYFMGTFRRMFRNKTEMIEHFNY 68 >Z49908-8|CAA90098.1| 153|Caenorhabditis elegans Hypothetical protein C07E3.9 protein. Length = 153 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 160 CIMKQPYKTAIITSRMCHIVMLVLIDDRSLKVSTSSFMCNNKQCK-KSDVCDVDE 321 C+ A + +++C V + +DD S S+ +C++K K+ +CD D+ Sbjct: 67 CMHHDKCYDAAVDNKVCMDVEIEYVDDYSWSCMNSTAICSDKNMGCKAALCDCDK 121 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,192,209 Number of Sequences: 27780 Number of extensions: 269392 Number of successful extensions: 631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -