BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1119 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 26 0.31 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.73 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 6.8 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 40 FHIVCFKFAHYFLGDFMRESKSFQNLFEHFNFN 138 F IVC AHY L DF + +++F++N Sbjct: 12 FSIVCQAKAHYSLRDFKANIFQVKYQWKYFDYN 44 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.0 bits (52), Expect = 0.73 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 269 LCVTINNAKNPMFATWMNKKLFKEQR 346 L T+N N M AT+MN+ L Q+ Sbjct: 468 LMTTVNEGNNNMAATYMNECLLNIQK 493 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.8 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +3 Query: 438 SNKNICIDNSLPGYSN*IKKNLSRRPRKLHLLSI-----PITKSYLTDDIRCY 581 SN + +DN L GY N ++ + P + + + PI++ +T + CY Sbjct: 4 SNISELLDNLLRGYDNSVRPDFGGPPATVEVDIMVRSMGPISEVDMTYSMDCY 56 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 495 FLFSYYNQVGNCRYKYFYWKYIL 427 + +S YN N K +Y YI+ Sbjct: 89 YKYSNYNNYNNYNKKLYYKNYII 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,514 Number of Sequences: 438 Number of extensions: 3653 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -