BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1117 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0157 - 13556708-13556813,13556831-13557001,13559558-135597... 29 3.5 >10_07_0157 - 13556708-13556813,13556831-13557001,13559558-13559757, 13559809-13559835 Length = 167 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 105 GRSEAYKPP-HSIILMLKLLRDARRPITVLPRLILYCVCVK*LQP*ETVCAPALSLPYIY 281 G S +Y+PP HS+I LLR+ + LP LIL ++ LQ E+ AL+ P Y Sbjct: 41 GLSRSYEPPTHSVIGTQLLLRN-EDAVMFLPALILNLYLLEHLQKWESA---ALNAPAHY 96 Query: 282 S 284 S Sbjct: 97 S 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,748,339 Number of Sequences: 37544 Number of extensions: 222688 Number of successful extensions: 594 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -