BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1117 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79755-10|CAB02109.1| 2034|Caenorhabditis elegans Hypothetical p... 29 3.2 U57652-1|AAB02243.1| 2034|Caenorhabditis elegans FER-1 protein. 29 3.2 U67949-2|AAB07560.2| 368|Caenorhabditis elegans Hypothetical pr... 28 7.3 >Z79755-10|CAB02109.1| 2034|Caenorhabditis elegans Hypothetical protein F43G9.6 protein. Length = 2034 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 100 SPEGVKHTNHRIRLF*C*SCCGTRGVLSLCCLVLY 204 S GV T R R C CC RG L CC+ + Sbjct: 1828 SDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCF 1862 >U57652-1|AAB02243.1| 2034|Caenorhabditis elegans FER-1 protein. Length = 2034 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 100 SPEGVKHTNHRIRLF*C*SCCGTRGVLSLCCLVLY 204 S GV T R R C CC RG L CC+ + Sbjct: 1828 SDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCF 1862 >U67949-2|AAB07560.2| 368|Caenorhabditis elegans Hypothetical protein F55A4.2 protein. Length = 368 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 627 RPLDPHPPSGRARPRPDATD 686 +P HPP+ A PRPD T+ Sbjct: 20 KPPPTHPPAPTAAPRPDTTE 39 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,757,265 Number of Sequences: 27780 Number of extensions: 192719 Number of successful extensions: 395 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -