BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1116 (824 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.2 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 6.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.0 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 177 QPKAARRRLLQS*S-LTPYLKLKCLSLK 97 +PK + LL S + L+PYL+ CLS + Sbjct: 250 RPKMTPQSLLPSQTGLSPYLRFGCLSTR 277 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 255 KRLAFNYLEEIAQEFFQQYGHRLNTVTRPYTFIEFDTCM 371 + +++ +LE +A E + NTVT +T DT + Sbjct: 109 REISWIFLETVANENTTNCPEQKNTVTVTFTVQSDDTTL 147 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 628 NGSGGHLHQHR 596 +G+GG LH HR Sbjct: 297 DGAGGPLHDHR 307 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,605 Number of Sequences: 336 Number of extensions: 3217 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22621642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -