BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1115 (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 26 0.23 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 1.6 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 26.2 bits (55), Expect = 0.23 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 267 FAHRNGYGLSFMYKAVIVA*SRLPFKRRYQNID 169 FA YG +++ +++ L FK+RYQ I+ Sbjct: 167 FALHEFYGFCYLWVLILICNIALAFKQRYQLIN 199 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 283 PRNIFFCASKWLWPIIYVQSSYCRLVT 203 P +FF ++ PI+Y+ SYC +VT Sbjct: 143 PDYVFFVENE---PILYLIFSYCPIVT 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,377 Number of Sequences: 336 Number of extensions: 1959 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -