BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1114 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 0.49 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 0.49 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.5 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 6.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 6.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.1 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.4 bits (53), Expect = 0.49 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 586 REAVTWGAWAHRVPRETSRLLRHCAHQGLHGTHLRHEV 699 RE +TW H R +R R C H GT +R + Sbjct: 593 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 630 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.4 bits (53), Expect = 0.49 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 586 REAVTWGAWAHRVPRETSRLLRHCAHQGLHGTHLRHEV 699 RE +TW H R +R R C H GT +R + Sbjct: 485 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 522 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 176 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 81 K PG S GD + + V H T++ W Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 68 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 19/49 (38%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A+ P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 170 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 81 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 170 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 81 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 582 ITGGRNLGRVGTSCPARDIPAPSTLCTSRTPRDTPSPR 695 +T R P R+ +P++ S TPR T R Sbjct: 916 LTSPRQPAETHAGSPCRNSASPASSDRSGTPRSTNGDR 953 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/49 (24%), Positives = 18/49 (36%) Frame = +1 Query: 370 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNVPS 516 H + P Y + +R+A P TH + +Y D V S Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,970 Number of Sequences: 336 Number of extensions: 4369 Number of successful extensions: 21 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -