BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1113 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0396 - 28600855-28601475,28601579-28601761,28601970-286021... 30 2.0 06_02_0037 - 10856616-10856915,10857527-10860238 28 8.3 >02_05_0396 - 28600855-28601475,28601579-28601761,28601970-28602129, 28602217-28602795,28603044-28603618,28604161-28604176, 28605566-28605663,28605774-28606286 Length = 914 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 162 IFSLSLIPYFKINNVFVALISFIVLCQYIIIRAVISYFHFIVCKQFTFPPFS 317 +FS + P+F N+FV + F+ Y+++ I+Y+ F + TFP FS Sbjct: 485 LFSPLISPFFATANIFVGFVLFL----YVLV--PIAYWGFDLYNAKTFPIFS 530 >06_02_0037 - 10856616-10856915,10857527-10860238 Length = 1003 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 384 NILLTVLKACVVYHWLIHPNCK 319 ++L V+ CVV HWL+ P+ K Sbjct: 191 SLLSVVVFGCVVVHWLVAPSSK 212 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,698,858 Number of Sequences: 37544 Number of extensions: 238821 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -