BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1113 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41907| Best HMM Match : Reprolysin (HMM E-Value=9.2e-05) 29 3.6 SB_25711| Best HMM Match : Oxidored_q1_N (HMM E-Value=3) 29 3.6 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 28 6.4 SB_27573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_41907| Best HMM Match : Reprolysin (HMM E-Value=9.2e-05) Length = 656 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +3 Query: 120 LSLIASCKITN*IQIFSLSLIPYFKINNVFVALISFIVLCQYIIIRAVISYFHFIVCKQF 299 LS+I + I + I I + +I K NN+ + +I I++ +I+I + +S + Sbjct: 394 LSIIIAI-IIDVITILFIVIIIIIKDNNININIIIDIIINTFILINSSVSSSKTAISSST 452 Query: 300 TFPPFS 317 T PP S Sbjct: 453 TSPPLS 458 >SB_25711| Best HMM Match : Oxidored_q1_N (HMM E-Value=3) Length = 166 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +3 Query: 120 LSLIASCKITN*IQIFSLSLIPYFKINNVFVALISFIVLCQYIIIRAVISYFHFIVCKQF 299 LS+I + I + I I + +I K NN+ + +I I++ +I+I + +S + Sbjct: 80 LSIIIAI-IIDVITILFIVIIIIIKDNNININIIIDIIINTFILINSSVSSSKTAISSST 138 Query: 300 TFPPFS 317 T PP S Sbjct: 139 TSPPLS 144 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 274 FILLYANNLRSRLFHFAIRVNQPVVHHTC 360 +IL+Y N +S+ F F R Q ++ C Sbjct: 439 YILVYCKNFKSKRFRFGFRFGQGILSSDC 467 >SB_27573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 42 NYIPIEQKYTYKHEHLKIHI 101 N +P+ +KYTY H K+H+ Sbjct: 151 NGMPVTRKYTYTHPDTKMHV 170 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/30 (33%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -1 Query: 614 IKLNYYCFVY-Y*HINIKLHCFIYYYVYSF 528 I++ +Y ++Y Y +I I ++ +IY Y Y++ Sbjct: 5 IQVTFYIYIYIYIYIYIYIYIYIYTYTYTY 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,182,642 Number of Sequences: 59808 Number of extensions: 337241 Number of successful extensions: 713 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -