BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1113 (701 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 4.0 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 7.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.3 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 590 VYY*HINIKLHCFIYYYV 537 ++Y H++ + CFIY YV Sbjct: 259 LHYLHLSTSIWCFIYIYV 276 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 198 NNVFVALISFIVLCQYIIIRAVIS 269 N F ISF VLC ++II ++ Sbjct: 1399 NIAFPYFISFYVLCSFLIINLFVA 1422 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 498 LTAY--YKIRLPKRIYIIIYKTM*LNINMLIINE 593 +TAY +K+ L + Y+++Y N+N + + E Sbjct: 1286 VTAYRRFKVALKRPAYVVVYDYYNTNLNAIKVYE 1319 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 9.3 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +2 Query: 203 CLRSFNKFYCIMSIYYYKGCHFIFSFYCMQTIYVPAFFILQL 328 C+++ N +C M + + CH YC + V QL Sbjct: 45 CIQTTNCRWCTMPNFTHPRCHGQIEKYCPEEYTVDPSNTFQL 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,846 Number of Sequences: 2352 Number of extensions: 12143 Number of successful extensions: 51 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -