BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1113 (701 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73424-4|CAA97778.2| 954|Caenorhabditis elegans Hypothetical pr... 28 7.4 AF016683-3|AAB66193.1| 497|Caenorhabditis elegans Hypothetical ... 28 7.4 >Z73424-4|CAA97778.2| 954|Caenorhabditis elegans Hypothetical protein C44B9.1 protein. Length = 954 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 299 YVPAFFILQLG*ISQWYTTHAFNTVSNMFIYSP 397 Y+ A+++ + G + QW TH+ SN+ Y P Sbjct: 888 YIKAYYLPENG-LEQWIKTHSVRGFSNLINYFP 919 >AF016683-3|AAB66193.1| 497|Caenorhabditis elegans Hypothetical protein K09F6.2 protein. Length = 497 Score = 27.9 bits (59), Expect = 7.4 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 629 TNNDIIKLNYYCFVYY*HINIKLHCFIYY 543 ++N + KL ++CF ++ +N+ CF+ + Sbjct: 466 SSNSLSKLVFFCFFFHFSLNVFFCCFVIF 494 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,507,793 Number of Sequences: 27780 Number of extensions: 271433 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -