BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1111 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 5.4 AY341191-1|AAR13755.1| 191|Anopheles gambiae GNBP B1 protein. 23 9.4 AY341190-1|AAR13754.1| 191|Anopheles gambiae GNBP B1 protein. 23 9.4 AY341189-1|AAR13753.1| 191|Anopheles gambiae GNBP B1 protein. 23 9.4 AY341188-1|AAR13752.1| 191|Anopheles gambiae GNBP B1 protein. 23 9.4 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 23 9.4 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 23 9.4 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 23 9.4 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 5.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 276 LHVVTRLMQKKMLILNRGKQTKNIDNIVCKQFVTWSR 166 ++++TRL ++ L +N NI+C VTW+R Sbjct: 938 MYLLTRLRLEQDL--QADFDVENAINIMCSDEVTWNR 972 >AY341191-1|AAR13755.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 21 CVRSVTTASGSLIDRG 36 >AY341190-1|AAR13754.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 21 CVRSVTTASGSLIDRG 36 >AY341189-1|AAR13753.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 21 CVRSVTTASGSLIDRG 36 >AY341188-1|AAR13752.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 21 CVRSVTTASGSLIDRG 36 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 86 TTSPPEPRSLIGRVRREQERL 24 T + PEP L+ + R+ ERL Sbjct: 77 TLAGPEPHQLLDELERDIERL 97 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 39 CVRSVTTASGSLIDRG 54 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 251 CINLVTTCKSNLIDQG 298 C+ VTT +LID+G Sbjct: 39 CVRSVTTASGSLIDRG 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,448 Number of Sequences: 2352 Number of extensions: 10230 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -