BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1111 (577 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069497-1|AAL39642.1| 602|Drosophila melanogaster LD22344p pro... 34 0.16 AE014134-1751|AAF52846.3| 602|Drosophila melanogaster CG4747-PA... 34 0.16 DQ138866-1|ABA86472.1| 1024|Drosophila melanogaster CG10719 prot... 31 1.5 AY129441-1|AAM76183.1| 1095|Drosophila melanogaster LD16270p pro... 31 1.5 AY122207-1|AAM52719.1| 357|Drosophila melanogaster LP03649p pro... 31 1.5 AF195873-1|AAF13929.1| 1037|Drosophila melanogaster brain tumor ... 31 1.5 AF195872-1|AAF13928.1| 1037|Drosophila melanogaster brain tumor ... 31 1.5 AF119332-1|AAF03086.1| 1037|Drosophila melanogaster brain tumor ... 31 1.5 AE014134-3055|AAS64719.1| 1037|Drosophila melanogaster CG10719-P... 31 1.5 AE014134-3054|AAF53771.1| 1037|Drosophila melanogaster CG10719-P... 31 1.5 AE014134-3053|AAN11027.1| 1037|Drosophila melanogaster CG10719-P... 31 1.5 AB022432-1|BAA82071.1| 1037|Drosophila melanogaster transcriptio... 31 1.5 >AY069497-1|AAL39642.1| 602|Drosophila melanogaster LD22344p protein. Length = 602 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 218 CFPLFKINIFFCINLVTTCKSNLIDQGVLRISIIG 322 CF N FF N+ CK NLI Q +L +S++G Sbjct: 465 CFKTIAKNTFFLGNIGNACKVNLILQTILGVSLVG 499 >AE014134-1751|AAF52846.3| 602|Drosophila melanogaster CG4747-PA protein. Length = 602 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 218 CFPLFKINIFFCINLVTTCKSNLIDQGVLRISIIG 322 CF N FF N+ CK NLI Q +L +S++G Sbjct: 465 CFKTIAKNTFFLGNIGNACKVNLILQTILGVSLVG 499 >DQ138866-1|ABA86472.1| 1024|Drosophila melanogaster CG10719 protein. Length = 1024 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 916 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 944 >AY129441-1|AAM76183.1| 1095|Drosophila melanogaster LD16270p protein. Length = 1095 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 981 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 1009 >AY122207-1|AAM52719.1| 357|Drosophila melanogaster LP03649p protein. Length = 357 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 243 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 271 >AF195873-1|AAF13929.1| 1037|Drosophila melanogaster brain tumor protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AF195872-1|AAF13928.1| 1037|Drosophila melanogaster brain tumor protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AF119332-1|AAF03086.1| 1037|Drosophila melanogaster brain tumor protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AE014134-3055|AAS64719.1| 1037|Drosophila melanogaster CG10719-PC, isoform C protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AE014134-3054|AAF53771.1| 1037|Drosophila melanogaster CG10719-PB, isoform B protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AE014134-3053|AAN11027.1| 1037|Drosophila melanogaster CG10719-PA, isoform A protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 >AB022432-1|BAA82071.1| 1037|Drosophila melanogaster transcription factor protein. Length = 1037 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 265 NDMQK*F---NRSRCIKDFNYRHRYIRKV 342 ND Q+ F NR+ C+K FNY +Y+R++ Sbjct: 923 NDKQEIFISDNRAHCVKVFNYEGQYLRQI 951 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,819,172 Number of Sequences: 53049 Number of extensions: 420206 Number of successful extensions: 1075 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2276053890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -