BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1110 (744 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 3.7 SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces p... 26 6.5 SPBC428.13c |mob1||protein kinase regulator Mob1|Schizosaccharom... 25 8.6 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 26.6 bits (56), Expect = 3.7 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +2 Query: 401 KGYFTPFDGYTSAIVGFIVSLPS*VLGGQRLGSGPWIAVSDGNHSPSGGPYARLP 565 +GYF+P Y+SA+ G +S+PS G R S IA + PYA P Sbjct: 237 RGYFSPMHTYSSAVPG-PISVPSAPYG--RASS--TIAEVSPMYGSHAAPYASTP 286 >SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 599 Score = 25.8 bits (54), Expect = 6.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 187 KHFKYKNKCVERLCTVTIRRYNIIDIT 267 K FK + CV +CT+T R++ + T Sbjct: 23 KAFKGNHPCVPSVCTITYSRFHCLPDT 49 >SPBC428.13c |mob1||protein kinase regulator Mob1|Schizosaccharomyces pombe|chr 2|||Manual Length = 210 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 72 PKTQRNIVV-IYISLSLCYGYIYCIFFYVYVTVGL 173 PK R ++ I+ L Y +IYC F+V V + L Sbjct: 139 PKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMEL 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,074,832 Number of Sequences: 5004 Number of extensions: 67635 Number of successful extensions: 142 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -