BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1110 (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 25 0.99 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.3 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 5.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 7.0 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 24.6 bits (51), Expect = 0.99 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 100 SIFLCPFAMAISIVFFSTSTSL*VLAFVLKHFKYKNKCVERLC 228 S P+A+ S +FF +TSL V+A V + RLC Sbjct: 136 STMAIPYAVTKSAMFFFAATSLLVVAEVCYFTAHVTHPRHRLC 178 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = -2 Query: 233 TVHSLSTHLFLYLKCFNTNAKTYSDVDVEKNTIDIAIAKGQRNIDNNYISLCLW 72 T H H +C+++++ SD D K + +G + D+N L W Sbjct: 231 TTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGNES-DHNDGRLRYW 283 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 112 CPFAMAISIVFFSTSTSL*VLAFVLKHFKYK 204 CPF + + FS++ S + FV+ YK Sbjct: 198 CPFTEHLGYLIFSSTISFYLPLFVMVFTYYK 228 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.0 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 142 FFS-TSTSL*VLAFVLKHFKYKNKCVERLCTVTIRRYN 252 FFS +STS V++ LKHF ++ V+ R Y+ Sbjct: 248 FFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYD 285 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 534 EWLPSLTAIQGPDPSRC 484 E+LP L I P P+ C Sbjct: 579 EFLPKLKGIPDPXPNTC 595 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,132 Number of Sequences: 438 Number of extensions: 4955 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -