BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1105 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.16 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 25 0.83 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 24 1.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 24 1.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.4 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.9 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 22 5.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.9 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 7.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.8 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 27.1 bits (57), Expect = 0.16 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 356 IMIGHTSCTICTRDLKISKCPCPLLATPRTVC 451 I G SCT+CT D K + C + + C Sbjct: 767 IPTGFDSCTVCTCDAKYLEIKCKRIYNEKQCC 798 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.6 bits (51), Expect = 0.83 Identities = 15/73 (20%), Positives = 31/73 (42%) Frame = +1 Query: 328 MECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFGDEEFD 507 +E + +E+ D K Y + + + L D++N +HT + GDE Sbjct: 410 LELFEELAEDKDGYKKFYEQFSK----NIKLGIHEDSQNRAKLSELLRYHTSASGDEACS 465 Query: 508 IL*YTGSMRRDQE 546 + Y ++ +Q+ Sbjct: 466 LKDYVSRIKPNQK 478 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 611 SSTGRLGPPGGAPSYQQPLNNATCASY-KWARLQVHQHSHQ 730 + G LGP G P Q +NN + + Q HQ HQ Sbjct: 144 TQNGVLGPTGSPPLTTQSMNNHHMGHHMQEQHPQHHQPHHQ 184 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 611 SSTGRLGPPGGAPSYQQPLNNATCASY-KWARLQVHQHSHQ 730 + G LGP G P Q +NN + + Q HQ HQ Sbjct: 146 TQNGVLGPTGSPPLTTQSMNNHHMGHHMQEQHPQHHQPHHQ 186 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 17 APGHGLQPTMGDYTQL 32 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 531 APGSGVQNTHIQYTQL 578 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 263 LKRYFDPCSRCTQIFGNRR*SESSLCCLLRQRDY*VQLSA 144 +K+Y S + + LC LL QR Y V+ SA Sbjct: 819 MKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSA 858 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 263 LKRYFDPCSRCTQIFGNRR*SESSLCCLLRQRDY*VQLSA 144 +K+Y S + + LC LL QR Y V+ SA Sbjct: 819 MKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSA 858 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 263 LKRYFDPCSRCTQIFGNRR*SESSLCCLLRQRDY*VQLSA 144 +K+Y S + + LC LL QR Y V+ SA Sbjct: 819 MKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSA 858 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 263 LKRYFDPCSRCTQIFGNRR*SESSLCCLLRQRDY*VQLSA 144 +K+Y S + + LC LL QR Y V+ SA Sbjct: 819 MKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSA 858 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 464 IRHFTLLHLVTKNLISFN 517 ++HF L L KN I FN Sbjct: 46 VKHFHPLALSNKNAIDFN 63 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 288 WTVIIFRVLCTNWNGVSTNCFR 353 WT+ L W+ STNC R Sbjct: 246 WTIYEMYHLAILWSCTSTNCPR 267 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 605 DESSTGRLGPPGGAPSYQQPLNN 673 D +ST + PP + SY P+N+ Sbjct: 65 DGASTPDVRPPSSSLSYGGPVND 87 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 605 DESSTGRLGPPGGAPSYQQPLNN 673 D +ST + PP + SY P+N+ Sbjct: 221 DGASTPDVRPPSSSLSYGGPVND 243 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,104 Number of Sequences: 336 Number of extensions: 4410 Number of successful extensions: 28 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -