BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1105 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 28 0.34 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 27 0.60 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.2 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 5.6 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 5.6 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 27.9 bits (59), Expect = 0.34 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = -1 Query: 394 SCTYCTACMTYHDFRKQFVDTPFQFVHRTRKIMTVHLQHQVLIFLKGTSTPAVAAHKYLA 215 +C CT C ++ D P Q V + R + + I +KGT AV Y++ Sbjct: 1392 NCVKCTRCRPKL-IQQPMADLPEQRVRQARPFSISGVDYAGPIMVKGTHRRAVPTKGYIS 1450 Query: 214 IDV 206 I V Sbjct: 1451 IFV 1453 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 27.1 bits (57), Expect = 0.60 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +3 Query: 498 RI*YPLIHGQHAPGSGVQNT-HIQYTQLH--HAAPQVGMMNPAQDGLAHQ 638 R+ Y L H QH PG+GVQ I Q H H Q ++ P + G A Q Sbjct: 225 RMEYLLPHQQHPPGAGVQGAGPIPSQQKHQQHQQQQQSVLLP-KHGTARQ 273 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 509 SFNTRAACAGIRSPEYAYSVHTITPRCAAGRHDE 610 ++ + A C G AY V +TP AA R+++ Sbjct: 641 NYRSYAQCKGRAKAPGAYHVLFVTPENAASRNEQ 674 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.8 bits (49), Expect = 5.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 632 PPGGAPSYQQPLNNATCASY 691 P G P+Y++P N A++ Sbjct: 379 PTGAPPTYEEPFRNVATANH 398 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 287 FTASSTDFLKRYFDPCSRCTQIFGNRR 207 + + DF K+Y PC +FG+ R Sbjct: 21 YLTHNNDFFKKYPIPCLPVEPLFGSSR 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,762 Number of Sequences: 2352 Number of extensions: 19769 Number of successful extensions: 77 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -