BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1102 (346 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizos... 24 5.8 SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schi... 24 7.6 >SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 24.2 bits (50), Expect = 5.8 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 259 YYCIIYVCQKSTAPLLKITKMPKALTIEI 173 ++C + Q+S ++ I+K+P+ L I+I Sbjct: 287 WHCPVCKVQRSAKKVIMISKLPEYLIIQI 315 >SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schizosaccharomyces pombe|chr 2|||Manual Length = 1107 Score = 23.8 bits (49), Expect = 7.6 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -1 Query: 292 LNPKANNTGLFYYCIIYVCQKSTAPLLKITKMPKALTIE--IYNQSTKYI 149 LN +NNT F+Y ++ ++ + + +L ++ IY + KY+ Sbjct: 121 LNESSNNTWHFHYIVLLWLSQALNTPFPLNSLDDSLDVKKTIYTIAIKYL 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,243,935 Number of Sequences: 5004 Number of extensions: 20985 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 102111100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -